PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_28654_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family STAT
Protein Properties Length: 587aa    MW: 66515.9 Da    PI: 7.3593
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_28654_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT197.41.4e-61241411118
            STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkky 95 
                     ldvvllna+gqpv+kd+ev asLlyad+g +vek++d eapLL+sydG+ef+s+drp+k+l+GrasfklkisqLsskcdnrLfri+fe++kl  +
  Neem_28654_f_1  24 LDVVLLNAFGQPVNKDMEVTASLLYADTGGLVEKTNDGEAPLLTSYDGIEFASYDRPSKILHGRASFKLKISQLSSKCDNRLFRIRFEVLKLAGF 118
                     8********************************************************************************************** PP

            STAT  96 pfleavskpirCisrsrntrsss 118
                     pflea+s+ irCisr+r++r+  
  Neem_28654_f_1 119 PFLEALSRAIRCISRNRTVRTCP 141
                     ******************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.505.105.9E-6403458IPR000980SH2 domain
SuperFamilySSF555501.24E-8405478IPR000980SH2 domain
PROSITE profilePS500019.351408468IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MAFGALLAAR LDIRKASCRR IFSLDVVLLN AFGQPVNKDM EVTASLLYAD TGGLVEKTND  60
GEAPLLTSYD GIEFASYDRP SKILHGRASF KLKISQLSSK CDNRLFRIRF EVLKLAGFPF  120
LEALSRAIRC ISRNRTVRTC PIICKKTPAA IHPLDGSQSC GFDDGSVEIQ HNTVREAKPS  180
PSSKRVRLEQ EKISAMEQPE GECDSHPWTA NRAENAFGKA SDGRRENLEE VEISPSDSES  240
TGARNSSFKS NENSVSDLTI FKYCLGSLTE RSLLLKEIAT SFSDEEILEF AHQVSIYSGC  300
SHHRYQIIIA KRLIEEGRNA WNMISQNNHP VHWDSAVFEI EEQFMKICCC SIRSLTQQDF  360
DLLRRIAGCQ DYLAQENFEK LWCWLYPVAF TLSRDWINTT WKSTSPKWIE GFITKEEAER  420
SLHGPRGLQE PGTFVLRFPT SRSWPHPDAG SLIVTYVGSD YTLHHRQVSV DYIYRDMEVK  480
PLQDLLMLEP ELSRLGRQDI SQLQLFLFSF TSLILPISGT KSNRPTLIPT EKKGRVEGHG  540
EVAFAFKFGS RESSCLTRLH AHLLILLASL IPKLLHQFQK QVAEILW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006442321.10.0hypothetical protein CICLE_v10019120mg
TrEMBLV4U0620.0V4U062_9R
STRINGVIT_19s0014g00140.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52052645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-177SH2 domain protein B